Pfam domain
Pfam family: Ribosomal_S18 (PF01084.19)
Uniprot AC: P0A7T7
RecName: 30S ribosomal protein S18
Begin-End: 20-68
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLL
Structures of the domain P0A7T7 20-68
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 R 20-68 None
5no4 X-ray 5.16 R 20-68 None
5no2 X-ray 5.16 R 20-68 None
4a2i X-ray 16.5 R 19-67 None
4adv X-ray 13.5 R 19-67 None
5my1 X-ray 7.6 R 19-67 None


© NPIDB team 2003 - 2019

text