Pfam domain
Pfam family: Ribosomal_S19 (PF00203.20)
Uniprot AC: P0A7U3
RecName: 30S ribosomal protein S19
Begin-End: 3-81
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFV
TDEMVGHKLGEFAPTRTYR
Structures of the domain P0A7U3 3-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 S 3-80 None
5no4 X-ray 5.16 S 3-80 None
5no2 X-ray 5.16 S 3-80 None
2ykr X-ray 9.8 S 2-79 None
5uz4 X-ray 5.8 S 2-79 None
4a2i X-ray 16.5 S 2-79 None
4adv X-ray 13.5 S 2-79 None
5my1 X-ray 7.6 S 2-79 None


© NPIDB team 2003 - 2019

text