Pfam domain
Pfam family: Ribosomal_S20p (PF01649.17)
Uniprot AC: P0A7U7
RecName: 30S ribosomal protein S20
Begin-End: 3-84
Organism: Escherichia coli
Interaction Mode:   

Sequence:
NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDRQA
AKGLIHKNKAARHKANLTAQIN
Structures of the domain P0A7U7 3-84
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 T 2-84 None
5no4 X-ray 5.16 T 2-84 None
5no2 X-ray 5.16 T 2-84 None
2ykr X-ray 9.8 T 2-83 None
5uz4 X-ray 5.8 T 2-83 None
4a2i X-ray 16.5 T 2-83 None
4adv X-ray 13.5 T 2-83 None
5my1 X-ray 7.6 T 2-83 None


© NPIDB team 2003 - 2019

text