Pfam domain
Pfam family: Ribosomal_S2 (PF00318.19)
Uniprot AC: P0A7V0
RecName: 30S ribosomal protein S2
Begin-End: 9-224
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKIL
FVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDK
LTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVD
TNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREG
Structures of the domain P0A7V0 9-224
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 B 9-224 None
2ykr X-ray 9.8 B 8-223 None
5uz4 X-ray 5.8 B 9-224 None
4a2i X-ray 16.5 B 8-223 None
4adv X-ray 13.5 B 8-223 None
5my1 X-ray 7.6 B 8-223 None


© NPIDB team 2003 - 2019

text