Pfam domain
Pfam family: Ribosomal_S4 (PF00163.18)
Uniprot AC: P0A7V8
RecName: 30S ribosomal protein S4
Begin-End: 3-66
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKPRLSDYGVQLREKQKVR
RIYG
Structures of the domain P0A7V8 3-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u4j X-ray 3.7 d 3-66 None


© NPIDB team 2003 - 2019

text