Pfam domain
Pfam family: S4 (PF01479.24)
Uniprot AC: P0A7V8
RecName: 30S ribosomal protein S4
Begin-End: 96-143
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GRLDNVVYRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVV
Structures of the domain P0A7V8 96-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 D 97-143 None
5no4 X-ray 5.16 D 97-143 None
5no2 X-ray 5.16 D 97-143 None
2ykr X-ray 9.8 D 96-142 None
5uz4 X-ray 5.8 D 96-142 None
4a2i X-ray 16.5 D 96-142 None
4adv X-ray 13.5 D 96-142 None
5my1 X-ray 7.6 D 96-142 None


© NPIDB team 2003 - 2019

text