Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: P0A7W1
RecName: 30S ribosomal protein S5
Begin-End: 11-75
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKARRN
MINVA
Structures of the domain P0A7W1 11-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 E 11-74 None
5no4 X-ray 5.16 E 11-74 None
5no2 X-ray 5.16 E 11-74 None
2ykr X-ray 9.8 E 10-73 None
5uz4 X-ray 5.8 E 10-73 None
4a2i X-ray 16.5 E 10-73 None
4adv X-ray 13.5 E 10-73 None
5my1 X-ray 7.6 E 10-73 None
5u4j X-ray 3.7 e 11-74 None


© NPIDB team 2003 - 2019

text