Pfam domain
Pfam family: Ribosomal_S5_C (PF03719.14)
Uniprot AC: P0A7W1
RecName: 30S ribosomal protein S5
Begin-End: 86-145
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLE
Structures of the domain P0A7W1 86-145
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u4j X-ray 3.7 e 87-145 None


© NPIDB team 2003 - 2019

text