Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: P0A7X3
RecName: 30S ribosomal protein S9
Begin-End: 10-130
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKG
GGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSK
R
Structures of the domain P0A7X3 10-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5no3 X-ray 5.16 I 10-130 None
5no4 X-ray 5.16 I 10-130 None
5no2 X-ray 5.16 I 10-130 None
2ykr X-ray 9.8 I 9-129 None
4a2i X-ray 16.5 I 9-129 None
4adv X-ray 13.5 I 9-129 None
5my1 X-ray 7.6 I 9-129 None


© NPIDB team 2003 - 2019

text