Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.25)
Uniprot AC: P0A7Z4
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 58-186
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITH
DGDVEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACY
SPVERIAYN
Structures of the domain P0A7Z4 58-186
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ipn X-ray 4.61 B 60-156 None
5ipn X-ray 4.61 A 60-156 None
5vt0 X-ray 3.78 H 60-156 None
5vt0 X-ray 3.78 G 60-156 None
4ylp X-ray 5.5 M 60-156 None
4ylp X-ray 5.5 N 60-156 None
4ylp X-ray 5.5 B 60-156 None
4ylp X-ray 5.5 A 60-156 None
4ylp X-ray 5.5 H 60-156 None
4ylp X-ray 5.5 G 60-156 None
4s20 X-ray 4.7 G 60-156 None
4s20 X-ray 4.7 F 60-156 None
4s20 X-ray 4.7 B 60-156 None
4s20 X-ray 4.7 A 60-156 None
6flp X-ray 4.1 B 60-156 None
6flp X-ray 4.1 A 60-156 None
5ipl X-ray 3.6 B 60-156 None
5ipl X-ray 3.6 A 60-156 None
5nsr X-ray 3.8 A 60-156 None
5nsr X-ray 3.8 B 60-156 None
5ipm X-ray 4.2 B 60-156 None
5ipm X-ray 4.2 A 60-156 None
6flq X-ray 4.1 B 60-156 None
6flq X-ray 4.1 A 60-156 None
6bjs X-ray 5.5 G 60-156 None
6bjs X-ray 5.5 H 60-156 None
5my1 X-ray 7.6 W 60-156 None
5my1 X-ray 7.6 V 60-156 None
6asx X-ray 3.8 H 60-156 None
6asx X-ray 3.8 G 60-156 None
6alh X-ray 4.4 G 60-156 None
6alh X-ray 4.4 H 60-156 None
3iyd X-ray 19.8 B 60-156 None
3iyd X-ray 19.8 A 60-156 None
6alg X-ray 3.7 G 60-156 None
6alg X-ray 3.7 H 60-156 None
5ms0 X-ray 9.8 B 60-156 None
5ms0 X-ray 9.8 A 60-156 None
6ca0 X-ray 5.75 B 60-156 None
6ca0 X-ray 5.75 A 60-156 None
6alf X-ray 4.1 G 60-156 None
6alf X-ray 4.1 H 60-156 None
5nss X-ray 5.8 B 60-156 None
5nss X-ray 5.8 A 60-156 None


© NPIDB team 2003 - 2019

text