Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.21)
Uniprot AC: P0A800
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-60
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
Structures of the domain P0A800 8-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ipn X-ray 4.61 E 10-59 None
5vt0 X-ray 3.78 K 10-59 None
4ylp X-ray 5.5 Q 10-59 None
4ylp X-ray 5.5 E 10-59 None
4ylp X-ray 5.5 K 10-59 None
6flp X-ray 4.1 E 10-59 None
5ipl X-ray 3.6 E 10-59 None
5nsr X-ray 3.8 E 10-59 None
5ipm X-ray 4.2 E 10-59 None
6flq X-ray 4.1 E 10-59 None
6bjs X-ray 5.5 K 10-59 None
5my1 X-ray 7.6 Z 10-59 None
6asx X-ray 3.8 K 10-59 None
6alh X-ray 4.4 K 10-59 None
3iyd X-ray 19.8 E 10-59 None
6alg X-ray 3.7 K 10-59 None
5ms0 X-ray 9.8 O 10-59 None
6ca0 X-ray 5.75 E 10-59 None
6alf X-ray 4.1 K 10-59 None
5nss X-ray 5.8 E 10-59 None


© NPIDB team 2003 - 2019

text