Pfam domain
Pfam family: RRF (PF01765.18)
Uniprot AC: P0A805
RecName: Ribosome-recycling factor
Begin-End: 20-183
Organism: Escherichia coli
Interaction Mode:   

Sequence:
FKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVE
KAIMASDLGLNPNSAGSDIRVPLPPLTEERRKDLTKIVRGEAEQARVAVRNVRRDANDKV
KALLKDKEISEDDDRRSQDDVQKLTDAAIKKIEAALADKEAELM
Structures of the domain P0A805 20-183
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1y69 X-ray 3.33 8 34-111 None
1zn0 X-ray 15.5 A 20-183 None
1zn1 X-ray 14.1 A 20-183 None
2rdo X-ray 9.1 8 20-183 None


© NPIDB team 2003 - 2019

text