Pfam domain
Pfam family: Trigger_N (PF05697.12)
Uniprot AC: P0A850
RecName: Trigger factor
Begin-End: 25-59
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYG
Structures of the domain P0A850 25-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1w2b X-ray 3.5 5 26-59 None


© NPIDB team 2003 - 2019

text