Pfam domain
Pfam family: HGTP_anticodon (PF03129.19)
Uniprot AC: P0A8M3
RecName: Threonine--tRNA ligase
Begin-End: 541-631
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QVVIMNITDSQSEYVNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKE
VESGKVAVRTRRGKDLGSMDVNEVIEKLQQE
Structures of the domain P0A8M3 541-631
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1kog X-ray 3.5 B 541-630 None
1kog X-ray 3.5 A 541-630 None
1kog X-ray 3.5 D 541-630 None
1kog X-ray 3.5 C 541-630 None
1kog X-ray 3.5 B 541-630 None
1kog X-ray 3.5 G 541-630 None
1kog X-ray 3.5 B 541-630 None
1kog X-ray 3.5 H 541-630 None
1kog X-ray 3.5 E 541-630 None
1kog X-ray 3.5 F 541-630 None
1qf6 X-ray 2.9 A 541-630 None


© NPIDB team 2003 - 2019

text