Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.11)
Uniprot AC: P0A8T7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 15-342
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
EEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLCGK
YKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSLPSRIGLLLDMPLRD
IERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDL
EQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVP
LDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGR
AITGSNKRPLKSLADMIKGKQGRFRQNL
Structures of the domain P0A8T7 15-342
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ylo X-ray 6 D 16-342 None
4ylo X-ray 6 J 16-342 None
4ylo X-ray 6 P 16-342 None
5ipn X-ray 4.61 D 16-342 None
5vt0 X-ray 3.78 J 17-342 None
4ylp X-ray 5.5 P 16-342 None
4ylp X-ray 5.5 D 16-342 None
4ylp X-ray 5.5 J 16-342 None
6flp X-ray 4.1 D 17-342  H-Bb L-Bb 
5ipl X-ray 3.6 D 16-342 None
5nsr X-ray 3.8 D 16-342 None
5ipm X-ray 4.2 D 16-342 None
6flq X-ray 4.1 D 17-342 None
6bjs X-ray 5.5 J 17-342  H-Mj L-Bb 
5my1 X-ray 7.6 Y 15-342 None
6asx X-ray 3.8 J 17-342  H-Bb H-Mj L-Bb 
6alh X-ray 4.4 J 17-342  H-Bb H-Mj L-Bb 
3iyd X-ray 19.8 D 16-342 None
6alg X-ray 3.7 J 17-342  H-Bb H-Mj L-Bb 
5ms0 X-ray 9.8 D 15-342 None
6ca0 X-ray 5.75 D 15-342 None
6alf X-ray 4.1 J 17-342  H-Bb H-Mj L-Bb 
5nss X-ray 5.8 D 16-342 None


© NPIDB team 2003 - 2019

text