Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.19)
Uniprot AC: P0A8T7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 344-401
Organism: Escherichia coli
Interaction Mode:   

Sequence:
GKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMV
Structures of the domain P0A8T7 344-401
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ylo X-ray 6 D 344-393 None
4ylo X-ray 6 J 344-393 None
4ylo X-ray 6 P 344-393 None
5ipn X-ray 4.61 D 344-393 None
5vt0 X-ray 3.78 J 344-393 None
4ylp X-ray 5.5 P 344-393 None
4ylp X-ray 5.5 D 344-393 None
4ylp X-ray 5.5 J 344-393 None
6flp X-ray 4.1 D 344-393 None
5ipl X-ray 3.6 D 344-393 None
5nsr X-ray 3.8 D 344-393 None
5ipm X-ray 4.2 D 344-393 None
6flq X-ray 4.1 D 344-393 None
6bjs X-ray 5.5 J 344-393 None
5my1 X-ray 7.6 Y 344-393 None
6asx X-ray 3.8 J 344-393 None
6alh X-ray 4.4 J 344-393 None
3iyd X-ray 19.8 D 344-393 None
6alg X-ray 3.7 J 344-393 None
5ms0 X-ray 9.8 D 344-393 None
6ca0 X-ray 5.75 D 344-393 None
6alf X-ray 4.1 J 344-393 None
5nss X-ray 5.8 D 344-393 None


© NPIDB team 2003 - 2019

text