Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: P0A8T7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 753-933
Organism: Escherichia coli
Interaction Mode:   

Sequence:
SIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTED
DCGTHEGIMMTPVIEGGDVKEPLRDRVLGRVTAEDVLKPGTADILVPRNTLLHEQWCDLL
EENSVDAVKVRSVVSCDTDFGVCAHCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQLTM
R
Structures of the domain P0A8T7 753-933
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pst X-ray 3 J 766-1142 None


© NPIDB team 2003 - 2021

text