Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.16)
Uniprot AC: P0A8T7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 766-1317
Organism: Escherichia coli
Interaction Mode:  H-Bb L-Bb 

Sequence:
GLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPV
IEGGDVKEPLRDRVLGRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSV
VSCDTDFGVCAHCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAA
AESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAK
GDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSA
ERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIP
QESGGTKDITGGLPRVADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDP
YEEMIPKWRQLNVFEGERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQG
VKINDKHIEVIVRQMLRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRD
LLGITKASLATE
Structures of the domain P0A8T7 766-1317
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ylo X-ray 6 D 766-1315 None
4ylo X-ray 6 J 766-1315 None
4ylo X-ray 6 P 766-1315 None
5ipn X-ray 4.61 D 766-1315 None
5vt0 X-ray 3.78 J 766-1315 None
4ylp X-ray 5.5 P 766-1315 None
4ylp X-ray 5.5 D 766-1315 None
4ylp X-ray 5.5 J 766-1315 None
6flp X-ray 4.1 D 766-1315 None
5ipl X-ray 3.6 D 766-1315 None
5nsr X-ray 3.8 D 766-1315 None
5ipm X-ray 4.2 D 766-1315 None
6flq X-ray 4.1 D 766-1315 None
6bjs X-ray 5.5 J 766-1315  L-Bb 
5my1 X-ray 7.6 Y 766-1315 None
6asx X-ray 3.8 J 766-1315  H-Bb 
6alh X-ray 4.4 J 766-1315  L-Bb 
3iyd X-ray 19.8 D 766-1315 None
6alg X-ray 3.7 J 766-1315  L-Bb 
5ms0 X-ray 9.8 D 766-1315 None
6ca0 X-ray 5.75 D 766-1315 None
6alf X-ray 4.1 J 766-1315  L-Bb 
5nss X-ray 5.8 D 766-1315 None


© NPIDB team 2003 - 2019

text