Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.11)
Uniprot AC: P0A8T8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 15-342
Organism: Escherichia coli O157:H7
Interaction Mode:  H-Bb L-Bb 

Sequence:
EEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCARIFGPVKDYECLCGK
YKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSLPSRIGLLLDMPLRD
IERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDL
EQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVP
LDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGR
AITGSNKRPLKSLADMIKGKQGRFRQNL
Structures of the domain P0A8T8 15-342
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6b6h X-ray 3.9 D 16-342  H-Bb L-Bb 


© NPIDB team 2003 - 2020

text