Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.19)
Uniprot AC: P0A8T8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 344-401
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
GKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMV
Structures of the domain P0A8T8 344-401
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6b6h X-ray 3.9 D 344-393 None


© NPIDB team 2003 - 2019

text