Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.16)
Uniprot AC: P0A8T8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 766-1317
Organism: Escherichia coli O157:H7
Interaction Mode:  H-Bb 

Sequence:
GLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPV
IEGGDVKEPLRDRVLGRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSV
VSCDTDFGVCAHCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAA
AESSIQVKNKGSIKLSNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAK
GDGEQVAGGETVANWDPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSA
ERTAGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIP
QESGGTKDITGGLPRVADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDP
YEEMIPKWRQLNVFEGERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQG
VKINDKHIEVIVRQMLRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRD
LLGITKASLATE
Structures of the domain P0A8T8 766-1317
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6b6h X-ray 3.9 D 766-1315  H-Bb 


© NPIDB team 2003 - 2020

text