Pfam domain
Pfam family: MetJ (PF01340.22)
Uniprot AC: P0A8U6
RecName: Met repressor
Begin-End: 3-99
Organism: Escherichia coli
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb 

Sequence:
EWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAF
LHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGIN
Structures of the domain P0A8U6 3-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1mjm X-ray 2.2 B 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjm X-ray 2.2 A 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjp X-ray 3.4 B 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjp X-ray 3.4 A 2-98  H-Bb S-Bb S-Mj 
1mjo X-ray 2.1 D 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjo X-ray 2.1 C 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjo X-ray 2.1 B 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjo X-ray 2.1 A 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjq X-ray 2.4 J 2-98  H-Bb S-Bb S-Mj 
1mjq X-ray 2.4 I 2-98  H-Bb S-Bb S-Mj 
1mjq X-ray 2.4 H 2-98  H-Bb S-Bb S-Mj 
1mjq X-ray 2.4 G 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjq X-ray 2.4 D 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjq X-ray 2.4 C 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjq X-ray 2.4 B 2-98  H-Bb S-Bb S-Mj L-Bb 
1mjq X-ray 2.4 A 2-98  H-Bb S-Bb S-Mj L-Bb 
1mj2 X-ray 2.4 D 2-98  H-Bb S-Bb S-Mj L-Bb 
1mj2 X-ray 2.4 C 2-98  H-Bb S-Bb S-Mj L-Bb 
1mj2 X-ray 2.4 B 2-98  H-Bb S-Bb S-Mj L-Bb 
1mj2 X-ray 2.4 A 2-98  H-Bb S-Bb S-Mj L-Bb 
1cma X-ray 2.8 B 2-98  H-Bb S-Bb S-Mj L-Bb 
1cma X-ray 2.8 A 2-98  H-Bb S-Bb S-Mj 


© NPIDB team 2003 - 2021

text