Pfam domain
Pfam family: RNA_pol_Rpb2_2 (PF04561.13)
Uniprot AC: P0A8V2
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 151-276
Organism: Escherichia coli
Interaction Mode:  L-Bb 

Sequence:
RSPGVFFDSDKGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIIL
RALNYTTEQILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEANGKVYVEKGRRIT
ARHIRQ
Structures of the domain P0A8V2 151-276
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ipn X-ray 4.61 C 151-225 None
5vt0 X-ray 3.78 I 151-225 None
4ylp X-ray 5.5 O 151-225 None
4ylp X-ray 5.5 C 151-225 None
4ylp X-ray 5.5 I 151-225 None
6flp X-ray 4.1 C 151-225 None
5ipl X-ray 3.6 C 151-225 None
5nsr X-ray 3.8 C 151-225 None
5ipm X-ray 4.2 C 151-225 None
6flq X-ray 4.1 C 151-225 None
6bjs X-ray 5.5 I 151-225  L-Bb 
5my1 X-ray 7.6 X 151-225 None
6asx X-ray 3.8 I 151-225  L-Bb 
6alh X-ray 4.4 I 151-225 None
6alg X-ray 3.7 I 151-225 None
5ms0 X-ray 9.8 C 151-235 None
6ca0 X-ray 5.75 C 151-225 None
6alf X-ray 4.1 I 151-225 None
5nss X-ray 5.8 C 151-225 None


© NPIDB team 2003 - 2019

text