Pfam domain
Pfam family: FadR_C (PF07840.14)
Uniprot AC: P0A8V6
RecName: Fatty acid metabolism regulator protein
Begin-End: 72-235
Organism: Escherichia coli
Interaction Mode:   

Sequence:
NNFWETSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATA
NEVADHADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALG
FYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQKNLPGDLA
Structures of the domain P0A8V6 72-235
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1h9t X-ray 3.25 A 72-237 None


© NPIDB team 2003 - 2021

text