Pfam domain
Pfam family: GntR (PF00392.23)
Uniprot AC: P0A8V6
RecName: Fatty acid metabolism regulator protein
Begin-End: 8-71
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGK
PTKV
Structures of the domain P0A8V6 8-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1hw2 X-ray 3.25 B 8-71  H-Bb H-Mj L-Bb L-Mj 
1hw2 X-ray 3.25 A 8-71  H-Bb H-Mj L-Bb L-Mj L-Mn 
1h9t X-ray 3.25 B 8-71  H-Bb H-Mj L-Bb L-Mj L-Mn 
1h9t X-ray 3.25 A 8-71  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text