Pfam domain
Pfam family: UDG (PF03167.18)
Uniprot AC: P0A9H1
RecName: G/U mismatch-specific DNA glycosylase
Begin-End: 3-160
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLLDY
RCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRGAQ
WGKQTLTIGSTQIWVLPNPSGLSRVSLEKLVEAYRELD
Structures of the domain P0A9H1 3-160
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1mtl X-ray 2.8 B 6-159 None
1mtl X-ray 2.8 A 6-159 None
1mwi X-ray 2.35 A 6-159 None
1mwj X-ray 2.85 A 6-159 None


© NPIDB team 2003 - 2020

text