Pfam domain
Pfam family: ABC_tran_Xtn (PF12848.6)
Uniprot AC: P0A9W3
RecName: Energy-dependent translational throttle protein EttA
Begin-End: 230-312
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LELDRGEGIPWEGNYSSWLEQKDQRLAQEASQEAARRKSIEKELEWVRQGTKGRQSKGKA
RLARFEELNSTEYQKRNETNELF
Structures of the domain P0A9W3 230-312
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j5s X-ray 7.5 D 230-306 None


© NPIDB team 2003 - 2019

text