Pfam domain
Pfam family: Ribosomal_L13 (PF00572.17)
Uniprot AC: P0AA10
RecName: 50S ribosomal protein L13
Begin-End: 14-138
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKV
YYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHA
AQQPQ
Structures of the domain P0AA10 14-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5gag X-ray 3.8 K 15-138 None
5aka X-ray 5.7 J 15-138 None
3j8g X-ray 5 J 15-138 None
5gae X-ray 3.33 K 15-138 None
3iy9 X-ray 14.1 J 869-992 None
5gah X-ray 3.8 K 41-138 None
5gad X-ray 3.7 K 15-138 None
4csu X-ray 5.5 J 15-138 None
5gaf X-ray 4.3 K 15-138 None
5ady X-ray 4.5 J 15-138 None
4uy8 X-ray 3.8 J 15-138 None
2rdo X-ray 9.1 J 15-138 None
3j5l X-ray 6.6 J 15-138 None
3bbx X-ray 10 J 15-138 None
2j28 X-ray 8 J 15-138 None
3j7z X-ray 3.9 J 15-138 None


© NPIDB team 2003 - 2019

text