Pfam domain
Pfam family: Thioredoxin (PF00085.19)
Uniprot AC: P0AA25
RecName: Thioredoxin 1
Begin-End: 4-106
Organism: Escherichia coli
Interaction Mode:  L-Bb 

Sequence:
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQ
NPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDA
Structures of the domain P0AA25 4-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1t8e X-ray 2.54 B 4-105  L-Bb 
1skw X-ray 2.3 B 4-105 None
1zyq X-ray 2.7 B 4-105 None
1tk8 X-ray 2.5 B 4-105 None
1sl0 X-ray 3.2 B 4-105 None
1sl0 X-ray 3.2 D 4-105 None
1tkd X-ray 2.49 B 4-105 None
2ajq X-ray 2.6 B 4-105  L-Bb 
2ajq X-ray 2.6 I 4-105 None
1x9m X-ray 2.1 B 4-105 None
1x9s X-ray 2.7 B 4-105 None
1x9w X-ray 2.3 B 4-105 None
1sl1 X-ray 2.2 B 4-105 None
1sl2 X-ray 2.3 B 4-105 None
1sks X-ray 2.3 B 4-105 None
1t7p X-ray 2.2 B 4-105 None
1tk0 X-ray 2.3 B 4-105 None
1tk5 X-ray 2.2 B 4-105 None
1skr X-ray 2.4 B 4-105 None


© NPIDB team 2003 - 2019

text