Pfam domain
Pfam family: FUR (PF01475.21)
Uniprot AC: P0AC51
RecName: Zinc uptake regulation protein
Begin-End: 19-140
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHK
VESTNSYVLCHLFDQPTHTSAMFICDRCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIE
AH
Structures of the domain P0AC51 19-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4mte X-ray 2.5 D 19-140  H-Bb H-Mj S-Bb L-Bb L-Mj 
4mte X-ray 2.5 C 19-140  H-Bb H-Mj S-Bb L-Bb L-Mj 
4mte X-ray 2.5 B 19-140  H-Bb H-Mj S-Bb L-Bb L-Mj 
4mte X-ray 2.5 A 19-140  H-Bb H-Mj S-Bb L-Bb L-Mj 
4mtd X-ray 2.5 A 19-140  H-Bb H-Mj S-Bb L-Bb L-Mj 
4mtd X-ray 2.5 B 19-140  H-Bb H-Mj S-Bb L-Bb L-Mj 
4mtd X-ray 2.5 D 19-140  H-Bb H-Mj S-Bb L-Bb L-Mj 
4mtd X-ray 2.5 C 19-140  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text