Pfam domain
Pfam family: Bac_DNA_binding (PF00216.23)
Uniprot AC: P0ACF4
RecName: DNA-binding protein HU-beta
Begin-End: 1-90
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTG
RNPQTGKEITIAAAKVPSFRAGKALKDAVN
Structures of the domain P0ACF4 1-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yew X-ray 2.68 A 1-76 None
4yft X-ray 2.91 A 1-74 None


© NPIDB team 2003 - 2021

text