Pfam domain
Pfam family: GyrI-like (PF06445.14)
Uniprot AC: P0ACI0
RecName: Right origin-binding protein
Begin-End: 126-288
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PEHKFVTLEDTPLIGVTQSYSCSLEQISDFRHEMRYQFWHDFLGNAPTIPPVLYGLNETR
PSQDKDDEQEVFYTTALAQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILTVYG
TCMPMLNLTRRKGQDIERYYPAEDAKAGDRPINLRCELLIPIR
Structures of the domain P0ACI0 126-288
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1d5y X-ray 2.7 D 127-288 None
1d5y X-ray 2.7 C 127-288 None
1d5y X-ray 2.7 A 127-288 None
1d5y X-ray 2.7 B 127-288 None


© NPIDB team 2003 - 2019

text