Pfam domain
Pfam family: cNMP_binding (PF00027.28)
Uniprot AC: P0ACJ8
RecName: cAMP-activated global transcriptional regulator CRP
Begin-End: 21-110
Organism: Escherichia coli
Interaction Mode:   

Sequence:
IHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEG
QERSAWVRAKTACEVAEISYKKFRQLIQVN
Structures of the domain P0ACJ8 21-110
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1run X-ray 2.7 A 22-108 None
1run X-ray 2.7 B 22-108 None
1zrd X-ray 2.8 B 22-108 None
1zrd X-ray 2.8 A 22-108 None
1o3s X-ray 3 A 22-108 None
1ruo X-ray 2.7 A 22-108 None
1ruo X-ray 2.7 B 22-108 None
1o3t X-ray 2.8 B 22-108 None
1o3t X-ray 2.8 A 22-108 None
1o3q X-ray 3 A 22-108 None
1lb2 X-ray 3.1 A 22-108 None
2cgp X-ray 2.2 A 22-108 None
1zre X-ray 2.8 B 22-108 None
1zre X-ray 2.8 A 22-108 None
1o3r X-ray 3 A 22-108 None
3n4m X-ray 2.99 A 22-108 None
1cgp X-ray 3 B 22-108 None
1cgp X-ray 3 A 22-108 None
1zrf X-ray 2.1 B 22-108 None
1zrf X-ray 2.1 A 22-108 None
1j59 X-ray 2.5 B 22-108 None
1j59 X-ray 2.5 A 22-108 None
1zrc X-ray 2.8 B 22-108 None
1zrc X-ray 2.8 A 22-108 None
3iyd X-ray 19.8 H 22-108 None
3iyd X-ray 19.8 G 22-108 None


© NPIDB team 2003 - 2019

text