Pfam domain
Pfam family: Peripla_BP_3 (PF13377.5)
Uniprot AC: P0ACP7
RecName: HTH-type transcriptional repressor PurR
Begin-End: 171-331
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAM
QQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTI
HQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSV
Structures of the domain P0ACP7 171-331
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1pnr X-ray 2.7 A 171-331 None
2pua X-ray 2.9 A 171-331 None
1bdi X-ray 3 A 171-331 None
1jh9 X-ray 2.55 A 171-331 None
1qqb X-ray 2.7 A 171-331 None
1vpw X-ray 2.7 A 171-331 None
1bdh X-ray 2.7 A 171-331 None
2puf X-ray 3 A 171-331 None
1qp4 X-ray 3 A 171-331 None
2pug X-ray 2.7 A 171-331 None
2pub X-ray 2.7 A 171-331 None
2puc X-ray 2.6 A 171-331 None
1jft X-ray 2.5 A 171-331 None
2pud X-ray 2.6 A 171-331 None
1zay X-ray 2.7 A 171-331 None
1qqa X-ray 3 A 171-331 None
1wet X-ray 2.6 A 171-331 None
1jfs X-ray 2.9 A 171-331 None
1qp7 X-ray 2.9 A 171-331 None
2pue X-ray 2.7 A 171-331 None
1qpz X-ray 2.5 A 171-331 None
1qp0 X-ray 2.9 A 171-331 None


© NPIDB team 2003 - 2019

text