Pfam domain
Pfam family: LacI (PF00356.20)
Uniprot AC: P0ACP7
RecName: HTH-type transcriptional repressor PurR
Begin-End: 3-48
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPS
Structures of the domain P0ACP7 3-48
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1pnr X-ray 2.7 A 3-48  H-Bb H-Mj L-Bb L-Mj 
2pua X-ray 2.9 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1bdi X-ray 3 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1jh9 X-ray 2.55 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1qqb X-ray 2.7 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1vpw X-ray 2.7 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1bdh X-ray 2.7 A 3-48  H-Bb H-Mj L-Bb L-Mj 
2puf X-ray 3 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1qp4 X-ray 3 A 3-48  H-Bb H-Mj L-Bb L-Mj 
2pug X-ray 2.7 A 3-48  H-Bb H-Mj L-Bb L-Mj 
2pub X-ray 2.7 A 3-48  H-Bb H-Mj L-Bb L-Mj 
2puc X-ray 2.6 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1jft X-ray 2.5 A 3-48  H-Bb H-Mj L-Bb L-Mj 
2pud X-ray 2.6 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1zay X-ray 2.7 A 3-48 None
1qqa X-ray 3 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1wet X-ray 2.6 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1jfs X-ray 2.9 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1qp7 X-ray 2.9 A 3-48  H-Bb H-Mj L-Bb L-Mj 
2pue X-ray 2.7 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1qpz X-ray 2.5 A 3-48  H-Bb H-Mj L-Bb L-Mj 
1qp0 X-ray 2.9 A 3-48  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text