Pfam domain
Pfam family: Ribosomal_S15 (PF00312.21)
Uniprot AC: P0ADZ4
RecName: 30S ribosomal protein S15
Begin-End: 8-87
Organism: Escherichia coli
Interaction Mode:   

Sequence:
TAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLL
DYLKRKDVARYTQLIERLGL
Structures of the domain P0ADZ4 8-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2vaz X-ray 10 F 108-186 None
5no3 X-ray 5.16 O 9-88 None
5no4 X-ray 5.16 O 9-88 None
5no2 X-ray 5.16 O 9-88 None
2ykr X-ray 9.8 O 8-87 None
5uz4 X-ray 5.8 O 8-87 None
4adv X-ray 13.5 O 8-87 None
5my1 X-ray 7.6 O 8-87 None


© NPIDB team 2003 - 2019

text