Pfam domain
Pfam family: MethyltransfD12 (PF02086.17)
Uniprot AC: P0AEE8
RecName: DNA adenine methylase
Begin-End: 10-246
Organism: Escherichia coli
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
WAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMR
TDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRG
EFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLSA
TANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVK
Structures of the domain P0AEE8 10-246
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2g1p X-ray 1.89 A 10-264  H-Bb S-Bb L-Bb L-Mj L-Mn 
2g1p X-ray 1.89 B 10-262  H-Bb S-Bb L-Bb L-Mj L-Mn 
4rto X-ray 2.69 A 10-259  H-Bb L-Bb L-Mj 
4rtq X-ray 2 A 10-264  H-Bb S-Bb L-Bb L-Mj 
4rts X-ray 2.49 A 10-264  H-Bb L-Bb L-Mj 
4rtm X-ray 2.5 A 10-264  H-Bb S-Bb L-Bb L-Mj 
4rtn X-ray 2.59 A 10-259  H-Bb S-Bb L-Bb L-Mj 
4rtj X-ray 1.99 A 10-258  H-Bb S-Bb L-Bb L-Mj 
4rtk X-ray 1.96 A 10-262  H-Bb S-Bb L-Bb L-Mj 
4rtr X-ray 2.39 A 10-264  H-Bb S-Bb L-Bb L-Mj 
4rtp X-ray 2.39 A 10-261  H-Bb S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text