Pfam domain
Pfam family: RNase_T (PF00929.23)
Uniprot AC: P0AEK0
RecName: Exodeoxyribonuclease 10
Begin-End: 4-147
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
IIDTETCGLQGGIVEIASVDVIDGKIVNPMSHLVRPDRPISPQAMAIHRITEAMVADKPW
IEDVIPHYYGSEWYVAHNASFDRRVLPEMPGEWICTMKLARRLWPGIKYSNMALYKTRKL
NVQTPPGLHHHRALYDCYITAALL
Structures of the domain P0AEK0 4-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4fzx X-ray 2.3 D 4-147  H-Bb H-Mn L-Mn 
4fzx X-ray 2.3 C 4-147  H-Bb L-Bb 
4fzz X-ray 2.8 A 4-147 None
4fzz X-ray 2.8 B 4-147 None
4fzy X-ray 2.5 A 4-147  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 
4fzy X-ray 2.5 B 4-147  H-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text