Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: P0AEM6
RecName: RNA polymerase sigma factor FliA
Begin-End: 185-234
Organism: Escherichia coli
Interaction Mode:   

Sequence:
AIETLPEREKLVLTLYYQEELNLKEIGAVLEVGESRVSQLHSQAIKRLRT
Structures of the domain P0AEM6 185-234
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pmi X-ray 3.86 F 185-234  H-Bb L-Bb 
6pmj X-ray 3.91 F 185-234  H-Bb 


© NPIDB team 2003 - 2021

text