Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: P0AEM6
RecName: RNA polymerase sigma factor FliA
Begin-End: 95-171
Organism: Escherichia coli
Interaction Mode:   

Sequence:
RNAREVAQAIGQLEQELGRNATETEVAERLGIDIADYRQMLLDTNNSQLFSYDEWREEHG
DSIELVTDDHQRENPLQ
Structures of the domain P0AEM6 95-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pmi X-ray 3.86 F 95-171  H-Bb 
6pmj X-ray 3.91 F 95-171 None


© NPIDB team 2003 - 2021

text