Pfam domain
Pfam family: DNA_gyraseA_C (PF03989.15)
Uniprot AC: P0AES4
RecName: DNA gyrase subunit A
Begin-End: 588-638
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DHILCFSSRGRVYSMKVYQLPEATRGARGRPIVNLLPLEQDERITAILPVT
Structures of the domain P0AES4 588-638
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rkw X-ray 6.6 C 588-638 None
6rkw X-ray 6.6 A 588-638 None


© NPIDB team 2003 - 2021

text