Pfam domain
Pfam family: HATPase_c (PF02518.28)
Uniprot AC: P0AES6
RecName: DNA gyrase subunit B
Begin-End: 31-175
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSA
AEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVP
QAPLAVTGETEKTGTMVRFWPSLET
Structures of the domain P0AES6 31-175
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rkw X-ray 6.6 D 31-175 None
6rkw X-ray 6.6 B 31-175 None


© NPIDB team 2003 - 2021

text