Pfam domain
Pfam family: GyrB_insert (PF18053.3)
Uniprot AC: P0AES6
RecName: DNA gyrase subunit B
Begin-End: 564-730
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ATLHTNASAPALAGEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADLSDE
QTVTRWVNALVSELNDKEQHGSQWKFDVHTNAEQNLFEPIVRVRTHGVDTDYPLDHEFIT
GGEYRRICTLGEKLRGLLEEDAFIERGERRQPVASFEQALDWLVKES
Structures of the domain P0AES6 564-730
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rkv X-ray 4.6 D 564-730 None
6rkv X-ray 4.6 B 564-730 None
6rku X-ray 4 D 564-730 None
6rku X-ray 4 B 564-730 None
6rkw X-ray 6.6 D 564-730 None
6rkw X-ray 6.6 B 564-730 None


© NPIDB team 2003 - 2021

text