Pfam domain
Pfam family: SBP_bac_1 (PF01547.27)
Uniprot AC: P0AEY0
RecName: Maltose/maltodextrin-binding periplasmic protein
Begin-End: 37-317
Organism: Escherichia coli O157:H7
Interaction Mode:   

Sequence:
INGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGY
AQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWE
EIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKA
GLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTF
KGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLE
Structures of the domain P0AEY0 37-317
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5w1c X-ray 3.18 A 13-292 None
5w1c X-ray 3.18 B 13-292 None
6dks X-ray 2.78 H 12-291 None
6dks X-ray 2.78 D 12-291 None
6dks X-ray 2.78 D 12-291 None
6dks X-ray 2.78 H 12-291 None
5zd4 X-ray 2.17 C -356--77 None
5zd4 X-ray 2.17 A -356--77 None
5zd4 X-ray 2.17 B -356--77 None
5w0u X-ray 2.9 A 13-292 None
5w0u X-ray 2.9 B 13-292 None


© NPIDB team 2003 - 2021

text