Pfam domain
Pfam family: NusA_N (PF08529.13)
Uniprot AC: P0AFF6
RecName: Transcription termination/antitermination protein NusA
Begin-End: 4-124
Organism: Escherichia coli
Interaction Mode:   

Sequence:
EILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWL
VVDEVTQPTKEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAER
A
Structures of the domain P0AFF6 4-124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ms0 X-ray 9.8 M 4-124 None
6tqn X-ray 3.8 A 4-124 None
6flq X-ray 4.1 F 4-124 None
6tqo X-ray 3.8 A 4-124 None
6xas X-ray 3.8 G 4-124 None


© NPIDB team 2003 - 2021

text