Pfam domain
Pfam family: HHH_5 (PF14520.8)
Uniprot AC: P0AFF6
RecName: Transcription termination/antitermination protein NusA
Begin-End: 431-487
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ADDLLNLEGVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARN
Structures of the domain P0AFF6 431-487
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tqn X-ray 3.8 A 431-487 None
6flq X-ray 4.1 F 431-487 None
6tqo X-ray 3.8 A 431-487 None


© NPIDB team 2003 - 2021

text