Pfam domain
Pfam family: Trans_reg_C (PF00486.27)
Uniprot AC: P0AFJ5
RecName: Phosphate regulon transcriptional regulatory protein PhoB
Begin-End: 150-225
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
EEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPG
GHDRMVQTVRGTGYRF
Structures of the domain P0AFJ5 150-225
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gxp X-ray 2.5 A 151-225  H-Bb H-Mj S-Bb L-Bb L-Mn 
1gxp X-ray 2.5 B 151-225  H-Bb H-Mj S-Bb L-Bb 
1gxp X-ray 2.5 F 151-225  H-Bb H-Mj S-Bb L-Bb 
1gxp X-ray 2.5 E 151-225  H-Bb H-Mj S-Bb L-Bb L-Mn 
2z33 NMR A 26-100  H-Bb H-Mj S-Bb L-Bb 
3t72 X-ray 4.33 8 151-225 None
3t72 X-ray 4.33 9 151-225 None
3t72 X-ray 4.33 4 151-225 None
3t72 X-ray 4.33 5 151-225 None
3t72 X-ray 4.33 1 151-225 None
3t72 X-ray 4.33 Z 151-225 None
3t72 X-ray 4.33 W 151-225 None
3t72 X-ray 4.33 V 151-225 None
3t72 X-ray 4.33 S 151-225 None
3t72 X-ray 4.33 R 151-225 None
3t72 X-ray 4.33 M 151-225 None
3t72 X-ray 4.33 N 151-225 None
3t72 X-ray 4.33 I 151-225 None
3t72 X-ray 4.33 J 151-225 None
3t72 X-ray 4.33 E 151-225 None
3t72 X-ray 4.33 F 151-225 None
3t72 X-ray 4.33 l 24-225 None
3t72 X-ray 4.33 k 24-225 None
3t72 X-ray 4.33 h 24-225 None
3t72 X-ray 4.33 g 24-225 None
3t72 X-ray 4.33 B 24-225 None
3t72 X-ray 4.33 A 24-225 None


© NPIDB team 2003 - 2020

text