Pfam domain
Pfam family: SeqA_N (PF17206.5)
Uniprot AC: P0AFY8
RecName: Negative modulator of initiation of replication
Begin-End: 1-35
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MKTIEVDDELYSYIASHTKHIGESASDILRRMLKF
Structures of the domain P0AFY8 1-35
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3fmt X-ray 2.98 F 1-60 None
3fmt X-ray 2.98 E 1-36 None
3fmt X-ray 2.98 A 1-36 None
3fmt X-ray 2.98 B 1-60 None


© NPIDB team 2003 - 2021

text