Pfam domain
Pfam family: SeqA (PF03925.15)
Uniprot AC: P0AFY8
RecName: Negative modulator of initiation of replication
Begin-End: 71-180
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
AMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLK
NGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGT
Structures of the domain P0AFY8 71-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1iu3 X-ray 3 F 5-115  H-Bb L-Bb L-Mj L-Mn 
1iu3 X-ray 3 C 5-115  H-Bb L-Bb L-Mj 
1j3e X-ray 2.5 A 5-115  H-Bb S-Bb L-Bb L-Mj L-Mn 
3fmt X-ray 2.98 F 70-180  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
3fmt X-ray 2.98 E 70-180  H-Bb S-Bb L-Bb L-Mj 
3fmt X-ray 2.98 B 70-180  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
3fmt X-ray 2.98 A 70-180  H-Bb S-Bb L-Bb L-Mj 
1lrr X-ray 2.65 D 70-180  H-Bb S-Bb L-Bb L-Mj 
1lrr X-ray 2.65 A 70-180  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text