Pfam domain
Pfam family: Rho_N (PF07498.11)
Uniprot AC: P0AG30
RecName: Transcription termination factor Rho
Begin-End: 5-47
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGE
Structures of the domain P0AG30 5-47
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1xpr X-ray 3.15 A 5-47 None
1xpr X-ray 3.15 B 5-47 None
1xpr X-ray 3.15 C 5-47 None
1xpr X-ray 3.15 D 5-47 None
1xpr X-ray 3.15 E 5-47 None
1xpr X-ray 3.15 F 5-47 None
2a8v X-ray 2.4 A 5-47 None
2a8v X-ray 2.4 B 5-47 None
2a8v X-ray 2.4 C 5-47 None
1xpu X-ray 3.05 A 5-47 None
1xpu X-ray 3.05 B 5-47 None
1xpu X-ray 3.05 C 5-47 None
1xpu X-ray 3.05 D 5-47 None
1xpu X-ray 3.05 E 5-47 None
1xpu X-ray 3.05 F 5-47 None
3ice X-ray 2.8 E 20-47 None
3ice X-ray 2.8 F 30-47 None
3ice X-ray 2.8 A 6-47 None
3ice X-ray 2.8 B 30-47 None
3ice X-ray 2.8 C 5-47 None
3ice X-ray 2.8 D 20-47 None
1pvo X-ray 3 F 5-47 None
1pvo X-ray 3 E 5-47 None
1pvo X-ray 3 D 5-47 None
1pvo X-ray 3 C 5-47 None
1pvo X-ray 3 A 5-47 None
1xpo X-ray 3.15 A 5-47 None
1xpo X-ray 3.15 B 5-47 None
1xpo X-ray 3.15 C 5-47 None
1xpo X-ray 3.15 D 5-47 None
1xpo X-ray 3.15 E 5-47 None
1xpo X-ray 3.15 F 5-47 None
1pv4 X-ray 3 F 5-47 None
1pv4 X-ray 3 E 5-47 None
1pv4 X-ray 3 D 5-47 None
1pv4 X-ray 3 A 5-47 None
1pv4 X-ray 3 C 5-47 None


© NPIDB team 2003 - 2019

text